status: run performed on Tue Jan 23 00:14:24 PST
2001; NR database of 606866 sequences; archived
Sequence: (length: 87)
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
MINRTDCNENSYLEIHNNEGRDTLCFANAGTMPVAIYGVNWVESGNNVVTLQFQRNLSDPRLETITLQKWGSWNPGHIHEILSIRIY
[Blast result]
PDB:
FFAS: [Score distribution]
id e-value zscore len code name
1 5.56 6.73 84 Z01/714 1f53A 259.1.4.1.1.1 yeast killer toxin-like protein 1f53A
2 15.6 5.62 44 A00/414 1myn_ 477.1.1.1.1.1 drosomycin 1myn_
3 28.2 4.98 71 Z01/403 1dw7A 000._._._._._ 8.3 KDA PROTEIN (GENE MTH1184); METHANOBACTERIUM THERMOAUTOTROPHICUM; 1dw7A 1gh9A
4 37.3 4.68 65 C00/237 2sn3_ 477.1.3.1.1.1 Scorpion neurotoxin (variant 3) 2sn3_ 1vnb_ 1vna_
5 46.0 4.45 98 F00/110 1ptoL 201.1.1.1.1.1 pertussis toxin 1ptoL 1ptoF 1prtL 1prtF 1bcpL 1bcpF
6 50.4 4.35 64 C00/029 2b3cA 477.1.3.1.1.1 neurotoxin cse-i 2b3cA 2b3c_ 1b3cA
7 53.0 4.30 129 Z01/401 1cuoA 238.1.2.2.1.1 azurin iso-2 1cuoA
8 62.2 4.12 159 B00/422 2pil_ 187.2.1.1.1.1 type 4 pilin (fimbriae) biological_unit 2pil_ 1ay2_
9 63.1 4.11 76 F00/044 1mntB 323.1.2.1.1.1 Mnt repressor mutant with c-terminal residues deleted ( 1mntB 1mntA 1qeyA 1qeyB 1qeyC 1qeyD
10 67.5 4.04 106 S00/010 2kauB 418.1.1.1.1.1 klebsiella aerogenes urease (urea amidohydrolase, ureas 2kauB 1krcB 1krbB 1kraB 1fwjB 1fwiB 1fwhB 1fwgB 1fwfB 1fweB 1fwdB 1fwcB 1fwbB 1fwaB 1a5oB 1a5nB 1a5mB 1a5lB 1a5kB 1ef2B 1ejrB 1ejsB 1ejtB 1ejuB 1ejvB
11 75.4 3.92 199 Z01/612 1f5jB 000._._._._._ BETA-1,4-XYLANASE; DICTYOGLOMUS THERMOPHILUM; 1f5jB 1f5jA
12 75.6 3.91 53 G00/054 3egf_ 433.4.1.1.1.1 Epidermal growth factor (egf) (NMR, 16 structures after 3egf_ 1epj_ 1epi_ 1eph_ 1epg_ 1egf_ 1a3p_
13 77.2 3.89 87 A00/018 1a6s_ 35.4.1.1.1.1 gag polyprotein fragment Mutant 1a6s_
14 77.3 3.89 94 A00/714 1b0xA 84.1.2.1.1.1 epha4 receptor tyrosine kinase fragment 1b0xA
15 77.8 3.88 65 G00/080 6hir_ 551.1.1.1.1.1 Hirudin (mutant with lys 47 replaced by glu) (K47E) (NM 6hir_ 5hir_ 4htcI 4hir_ 3htcI 2hir_ 1hrtI
16 80.4 3.85 122 B00/025 1bylA 294.1.1.1.1.1 bleomycin resistance protein (sh-ble) 1bylA 1byl_
17 85.3 3.78 111 Z01/424 1eiwA 154.2.5.1.1.1 hypothetical protein mth538 1eiwA
18 89.0 3.73 273 G00/075 2ramB 235.3.1.1.2.1 transcription factor nf-kb p65 fragment (rela) biologic 2ramB 2ramA 1vkxA 1ramB 1ramA 1nfiC 1nfiA
19 90.4 3.72 82 I00/025 1f0mA 84.1.2.1.1.1 ephrin type-b receptor 2 fragment (ephb2) 1f0mA 1sgg_ 1b4fA 1b4fB 1b4fC 1b4fD 1b4fE 1b4fF 1b4fG 1b4fH
PFAM_: run
COG__: run