status: run performed on Thu Jul 4 07:38:46 PDT 2002; NR database of 946396 sequences; archived
Sequence: (length: 184)
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADN
DLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWLEAQP
[Blast result]PDB:FFAS: [Score distribution]
id e-value zscore len code name
1 9.75e-15 44.35 152 A00/921 1cmzA 11.1.1.1.1.1 gaip (g-alpha interacting) protein fragment (galpha int 1cmzA
2 1.68e-13 41.23 205 B00/148 1agrH 11.1.1.1.1.1 guanine nucleotide-binding protein g(i) fragment (gi-al 1agrH 1agrE
3 1.55e-12 38.78 132 Z01/276 1dk8A 11.1.1.1.1.1 axin fragment 1dk8A 1emuA
4 46.9 4.70 158 A00/769 1dy3A 95.2.7.1.1.1 molecule (pppk, hppk) 1dy3A 1hka_ 1eqoA
5 49.5 4.64 162 E00/044 3dfr_ 171.1.1.1.1.1 Dihydrofolate reductase complex with nadph and methotre 3dfr_ 1diu_ 1dis_ 1ao8_ 1bzf_
6 49.7 4.64 116 D00/035 2hioA 56.1.5.1.1.1 histone h2a histone h2b histone h3 histone h4 2hioA 1hioA 1aoiG 1aoiC 1eqzA 1eqzE
7 50.9 4.62 160 Z01/014 1cbkA 95.2.7.1.1.1 7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase 1cbkA 1cbkB
8 63.3 4.37 992 E00/033 1bu7B 74.1.1.1.2.2 cytochrome p450 fragment (fatty acid hydroxylase) 1bu7B 1bu7A 1bvyA 1bvyF 1bvyB
9 74.5 4.19 224 B00/656 3gtuB 182.3.1.1.6.1 glutathione s-transferase biological_unit 3gtuB 3gtuD
10 76.3 4.17 217 Z00/049 6gsyB 182.3.1.1.6.1 mu class glutathione s-transferase of isoenzyme 3-3 (ra 6gsyB 6gsyA 6gsxB 6gsxA 6gswB 6gswA 6gsvB 6gsvA 6gsuB 6gsuA 6gstB 6gstA 5gstB 5gstA 4gstB 4gstA 3gstB 3gstA 2gstB 2gstA 1hncD 1hncC 1hncB 1hncA 1hnbB 1hnbA 1hna_ 1gscD 1gscC 1gscB 1gscA 1gsbD 1gsbC 1gsbB 1gsbA 1gtuA 1gtuB 1gtuC 1gtuD 5fwgA 5fwgB 2gtuA 2gtuB 3fygA 3fygB 3gtuA 3gtuC
11 78.2 4.14 217 H00/110 4gtuH 182.3.1.1.4.1 glutathione s-transferase 4gtuH 4gtuG 4gtuF 4gtuE 4gtuD 4gtuC 4gtuB 4gtuA
12 79.0 4.13 216 C00/148 2fheB 182.3.1.1.6.1 glutathione s-transferase (gst) ggl-cys-gly 2fheB 2fheA 1fhe_
13 80.3 4.11 219 B00/307 1gsuB 182.3.1.1.6.1 class-mu glutathione s-transferase (gst, cgstm1-1) biol 1gsuB 1gsuA 1c72A 1c72B 1c72C 1c72D
14 80.4 4.11 148 Z01/351 1f2uD 109.2.2.1.1.1 rad50 abc-atpase fragment rad50 abc-atpase fragment 1f2uD 1f2uB 1f2tB
15 82.1 4.09 159 Z01/076 1df7A 171.1.1.1.1.1 dihydrofolate reductase (dhfr) 1df7A 1dg5A 1dg7A 1dg8A
16 94.1 3.93 128 Z01/637 1f66G 000._._._._._ HISTONE H3; XENOPUS LAEVIS; 1f66G 1f66C
17 96.7 3.90 233 G00/011 1dugB 182.3.1.1.4.1 chimera of glutathione s-transferase-synthetic linker-c 1dugB 1dugA 1gtb_ 1gta_ 1gne_ 1bg5_ 1b8xA
18 105. 3.81 272 F00/029 1e1rG 1.1.9.1.1.1 bovine mitochondrial f1-atpase (atp synthase alpha chai 1e1rG 1e1qG 1qo1G 1nbmG 1mabG 1efrG 1cowG 1bmfG 1e79G
19 109. 3.77 119 A00/120 1bak_ 267.1.1.10.1.1 g-protein coupled receptor kinase 2 fragment (grk-2, be 1bak_
PFAM domains:FFAS: [Score distribution]
id e-value zscore len code name
1 5.37e-16 48.35 122 A01/849 PF00615 Regulator of G protein signaling domain
2 28.1 4.84 182 A00/037 PF00005 ABC transporter
3 42.1 4.38 116 A01/095 PF00125 Core histone H2A/H2B/H3/H4
4 56.2 4.05 659 A00/802 PF00771 FHIPEP family
5 64.4 3.89 497 A01/375 PF01642 Methylmalonyl-CoA mutase
6 70.2 3.79 665 A02/385 PF01496 V-type ATPase 116kDa subunit family
7 70.9 3.78 196 A00/840 PF00813 FliP family
8 77.9 3.67 103 A00/745 PF01133 Enhancer of rudimentary
9 79.6 3.65 187 A01/684 PF00613 Phosphoinositide 3-kinase family, accessory domain (PIK domain)
10 82.9 3.60 193 A02/125 PF01598 Sterol desaturase
11 83.9 3.59 175 A01/971 PF01782 RimM
12 94.5 3.45 316 A01/364 PF01078 Magnesium chelatase, subunit ChlI
13 99.4 3.39 202 A02/084 PF02483 SMC family, C-terminal domain
14 101. 3.37 359 A00/692 PF00968 Dwarfin
15 107. 3.30 168 A01/765 PF02125 Surfactant associated polypeptide
16 113. 3.24 165 A00/675 PF01931 Protein of unknown function DUF84
17 116. 3.22 202 A00/723 PF01912 eIF-6 family
18 120. 3.17 116 A01/218 PF02373 jmjC domain
19 122. 3.15 65 A02/314 PF02320 Ubiquinol-cytochrome C reductase hinge protein
Clusters of Orthologous Groups:FFAS: [Score distribution]
id e-value zscore len code name
1 79.8 4.11 287 A00/223 COG0224 F0F1-type ATP synthase gamma subunit
2 98.6 3.85 307 A02/714 COG3240 Phospholipase/lecithinase/hemolysin
3 116. 3.66 221 A01/170 COG1338 Flagellar biosynthesis/type III secretory pathway protein
4 126. 3.56 152 A01/169 COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains
5 126. 3.56 267 A00/930 COG1093 Translation initiation factor eIF2alpha
6 131. 3.51 338 A02/652 COG3178 Predicted phosphotransferases related to Ser/Thr protein kinases
7 135. 3.47 228 A00/982 COG1136 ABC-type (unclassified) transport system, ATPase component
8 147. 3.37 228 A02/368 COG2884 Predicted ATPase involved in cell division
9 149. 3.35 235 A02/417 COG2935 Putative arginyl-tRNA:protein arginylyltransferase
10 166. 3.22 182 A01/551 COG1711 Uncharacterized ArCR
11 169. 3.19 147 A02/286 COG2764 Uncharacterized BCR
12 173. 3.17 1065 A00/832 COG0841 Cation/multidrug efflux pump
13 174. 3.16 236 A00/476 COG0479 Succinate dehydrogenase/fumarate reductase Fe-S protein
14 184. 3.09 137 A02/200 COG2427 Uncharacterized ACR
15 188. 3.06 136 A02/586 COG3112 Uncharacterized BCR
16 189. 3.06 229 A02/709 COG3235 Uncharacterized membrane protein
17 191. 3.04 240 A02/149 COG2345 Predicted transcriptional regulator
18 193. 3.03 622 A00/834 COG0843 Heme/copper-type cytochrome/quinol oxidases, subunit 1
19 194. 3.02 320 A01/147 COG1305 Transglutaminase-like enzymes, putative cysteine proteases