status: run performed on Thu Jul 4 07:38:46 PDT 2002; NR database of 946396 sequences; archived
Sequence: (length: 184)
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADN
DLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWLEAQP
[Blast result]
PDB:
FFAS: [Score distribution]
id   e-value zscore	len	code	name
 1  9.75e-15 44.35	152	A00/921	1cmzA	11.1.1.1.1.1 gaip (g-alpha interacting) protein fragment (galpha int	1cmzA
 2  1.68e-13 41.23	205	B00/148	1agrH	11.1.1.1.1.1 guanine nucleotide-binding protein g(i) fragment (gi-al	1agrH 1agrE
 3  1.55e-12 38.78	132	Z01/276	1dk8A	11.1.1.1.1.1 axin fragment	1dk8A 1emuA
 4      46.9 4.70	158	A00/769	1dy3A	95.2.7.1.1.1 molecule (pppk, hppk)	1dy3A 1hka_ 1eqoA
 5      49.5 4.64	162	E00/044	3dfr_	171.1.1.1.1.1 Dihydrofolate reductase complex with nadph and methotre	3dfr_ 1diu_ 1dis_ 1ao8_ 1bzf_
 6      49.7 4.64	116	D00/035	2hioA	56.1.5.1.1.1 histone h2a histone h2b histone h3 histone h4	2hioA 1hioA 1aoiG 1aoiC 1eqzA 1eqzE
 7      50.9 4.62	160	Z01/014	1cbkA	95.2.7.1.1.1 7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase	1cbkA 1cbkB
 8      63.3 4.37	992	E00/033	1bu7B	74.1.1.1.2.2 cytochrome p450 fragment (fatty acid hydroxylase)	1bu7B 1bu7A 1bvyA 1bvyF 1bvyB
 9      74.5 4.19	224	B00/656	3gtuB	182.3.1.1.6.1 glutathione s-transferase biological_unit	3gtuB 3gtuD
10      76.3 4.17	217	Z00/049	6gsyB	182.3.1.1.6.1 mu class glutathione s-transferase of isoenzyme 3-3 (ra	6gsyB 6gsyA 6gsxB 6gsxA 6gswB 6gswA 6gsvB 6gsvA 6gsuB 6gsuA 6gstB 6gstA 5gstB 5gstA 4gstB 4gstA 3gstB 3gstA 2gstB 2gstA 1hncD 1hncC 1hncB 1hncA 1hnbB 1hnbA 1hna_ 1gscD 1gscC 1gscB 1gscA 1gsbD 1gsbC 1gsbB 1gsbA 1gtuA 1gtuB 1gtuC 1gtuD 5fwgA 5fwgB 2gtuA 2gtuB 3fygA 3fygB 3gtuA 3gtuC
11      78.2 4.14	217	H00/110	4gtuH	182.3.1.1.4.1 glutathione s-transferase	4gtuH 4gtuG 4gtuF 4gtuE 4gtuD 4gtuC 4gtuB 4gtuA
12      79.0 4.13	216	C00/148	2fheB	182.3.1.1.6.1 glutathione s-transferase (gst) ggl-cys-gly	2fheB 2fheA 1fhe_
13      80.3 4.11	219	B00/307	1gsuB	182.3.1.1.6.1 class-mu glutathione s-transferase (gst, cgstm1-1) biol	1gsuB 1gsuA 1c72A 1c72B 1c72C 1c72D
14      80.4 4.11	148	Z01/351	1f2uD	109.2.2.1.1.1 rad50 abc-atpase fragment rad50 abc-atpase fragment	1f2uD 1f2uB 1f2tB
15      82.1 4.09	159	Z01/076	1df7A	171.1.1.1.1.1 dihydrofolate reductase (dhfr)	1df7A 1dg5A 1dg7A 1dg8A
16      94.1 3.93	128	Z01/637	1f66G	000._._._._._ HISTONE H3; XENOPUS LAEVIS;	1f66G 1f66C
17      96.7 3.90	233	G00/011	1dugB	182.3.1.1.4.1 chimera of glutathione s-transferase-synthetic linker-c	1dugB 1dugA 1gtb_ 1gta_ 1gne_ 1bg5_ 1b8xA
18      105. 3.81	272	F00/029	1e1rG	1.1.9.1.1.1 bovine mitochondrial f1-atpase (atp synthase alpha chai	1e1rG 1e1qG 1qo1G 1nbmG 1mabG 1efrG 1cowG 1bmfG 1e79G
19      109. 3.77	119	A00/120	1bak_	267.1.1.10.1.1 g-protein coupled receptor kinase 2 fragment (grk-2, be	1bak_
PFAM domains:
FFAS: [Score distribution]
id   e-value zscore	len	code	name
 1  5.37e-16 48.35	122	A01/849	PF00615 Regulator of G protein signaling domain
 2      28.1 4.84	182	A00/037	PF00005 ABC transporter
 3      42.1 4.38	116	A01/095	PF00125 Core histone H2A/H2B/H3/H4
 4      56.2 4.05	659	A00/802	PF00771 FHIPEP family
 5      64.4 3.89	497	A01/375	PF01642 Methylmalonyl-CoA mutase
 6      70.2 3.79	665	A02/385	PF01496 V-type ATPase 116kDa subunit family
 7      70.9 3.78	196	A00/840	PF00813 FliP family
 8      77.9 3.67	103	A00/745	PF01133 Enhancer of rudimentary
 9      79.6 3.65	187	A01/684	PF00613 Phosphoinositide 3-kinase family, accessory domain (PIK domain)
10      82.9 3.60	193	A02/125	PF01598 Sterol desaturase
11      83.9 3.59	175	A01/971	PF01782 RimM
12      94.5 3.45	316	A01/364	PF01078 Magnesium chelatase, subunit ChlI
13      99.4 3.39	202	A02/084	PF02483 SMC family, C-terminal domain
14      101. 3.37	359	A00/692	PF00968 Dwarfin
15      107. 3.30	168	A01/765	PF02125 Surfactant associated polypeptide
16      113. 3.24	165	A00/675	PF01931 Protein of unknown function DUF84
17      116. 3.22	202	A00/723	PF01912 eIF-6 family
18      120. 3.17	116	A01/218	PF02373 jmjC domain
19      122. 3.15	65	A02/314	PF02320 Ubiquinol-cytochrome C reductase hinge protein
Clusters of Orthologous Groups:
FFAS: [Score distribution]
id   e-value zscore	len	code	name
 1      79.8 4.11	287	A00/223	COG0224 F0F1-type ATP synthase gamma subunit
 2      98.6 3.85	307	A02/714	COG3240 Phospholipase/lecithinase/hemolysin
 3      116. 3.66	221	A01/170	COG1338 Flagellar biosynthesis/type III secretory pathway protein
 4      126. 3.56	152	A01/169	COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains
 5      126. 3.56	267	A00/930	COG1093 Translation initiation factor eIF2alpha
 6      131. 3.51	338	A02/652	COG3178 Predicted phosphotransferases related to Ser/Thr protein kinases
 7      135. 3.47	228	A00/982	COG1136 ABC-type (unclassified) transport system, ATPase component
 8      147. 3.37	228	A02/368	COG2884 Predicted ATPase involved in cell division
 9      149. 3.35	235	A02/417	COG2935 Putative arginyl-tRNA:protein arginylyltransferase
10      166. 3.22	182	A01/551	COG1711 Uncharacterized ArCR
11      169. 3.19	147	A02/286	COG2764 Uncharacterized BCR
12      173. 3.17	1065	A00/832	COG0841 Cation/multidrug efflux pump
13      174. 3.16	236	A00/476	COG0479 Succinate dehydrogenase/fumarate reductase Fe-S protein
14      184. 3.09	137	A02/200	COG2427 Uncharacterized ACR
15      188. 3.06	136	A02/586	COG3112 Uncharacterized BCR
16      189. 3.06	229	A02/709	COG3235 Uncharacterized membrane protein
17      191. 3.04	240	A02/149	COG2345 Predicted transcriptional regulator
18      193. 3.03	622	A00/834	COG0843 Heme/copper-type cytochrome/quinol oxidases, subunit 1
19      194. 3.02	320	A01/147	COG1305 Transglutaminase-like enzymes, putative cysteine proteases