ExPASy Home page |
Site Map | Search ExPASy | Contact us | Swiss-Prot |
| Hosted by NCSC US | Mirror sites: | Canada | China | Korea | Switzerland | Taiwan |
|
Swiss-Prot Protein Knowledgebase What's new? Release 41.3 of 04-Apr-2003 |
| Release 41.3 of 04-Apr-2003 |
|---|
| Release 41.1 of 25-Mar-2003 |
|---|
The new format of the CC line topic ALTERNATIVE PRODUCTS is:
CC -!- ALTERNATIVE PRODUCTS: CC Event=Alternative promoter; CC Comment=Free text; CC Event=Alternative splicing; Named isoforms=n; CC Comment=Optional free text; CC Name=Isoform_1; Synonyms=Synonym_1[, Synonym_n]; CC IsoId=Isoform_identifier_1[, Isoform_identifer_n]; CC Sequence=Displayed; CC Note=Free text; CC Name=Isoform_n; Synonyms=Synonym_1[, Synonym_n]; CC IsoId=Isoform_identifier_1[, Isoform_identifer_n]; CC Sequence=VSP_identifier_1 [, VSP_identifier_n]; CC Note=Free text; CC Event=Alternative initiation; CC Comment=Free text;The qualifiers are described in the table below:
| Topic | Description |
|---|---|
| Event | Biological process that results in the production of the alternative
forms (Alternative promoter, Alternative splicing, Alternative initiation). Format: Event=controlled vocabulary; Example: Event=Alternative splicing; |
| Named isoforms | Number of isoforms listed in the topics 'Name' currently only for 'Event=Alternative splicing'. Format: Named isoforms=number; Example: Named isoforms=6; |
| Comment | Any comments concerning one or more isoforms;
optional for 'Alternative splicing';
in case of 'Alternative promoter' and 'Alternative initiation' there is always a
'Comment' of free text, which includes relevant information on the isoforms. Format: Comment=free text; Example: Comment=Experimental confirmation may be lacking for some isoforms; |
| Name | A common name for an isoform used in the literature or assigned by Swiss-Prot; currenty only available for spliced isoforms. Format: Name=common name; Example: Name=Alpha; |
Synonyms | Synonyms for an isoform as used in the literature; optional; currently only available for spliced isoforms. Format: Synonyms=Synonym_1[, Synonym_n]; Example: Synonyms=B, KL5; |
| IsoId | Unique identifier for an isoform, consisting of the Swiss-Prot accession
number, followed by a dash and a number. Format: IsoId=acc#-isoform_number[, acc#-isoform_number]; Example: IsoId=P05067-1; |
| Sequence | Information on the isoform sequence; the term 'Displayed' indicates, that the sequence
is shown in the entry; a lists of feature identifiers
(VSP_#) indicates that the isoform is annotated in the feature table; the FTIds enable programs to create
the sequence of a splice variant; if the accession number of the IsoId does not correspond to the accession
number of the current entry, this topic contains the term 'External';
'Not described' points out that the sequence of the isoform is unknown. Format: Sequence=VSP_#[, VSP_#]|Displayed|External|Not described; Example: Sequence=Displayed; Example: Sequence=VSP_000013, VSP_000014; Example: Sequence=External; Example: Sequence=Not described; |
| Note | Lists isoform-specific information; optional. Format: Note=Free text; Example: Note=No experimental confirmation available; |
... CC -!- ALTERNATIVE PRODUCTS: CC Event=Alternative splicing; Named isoforms=6; CC Name=1; CC IsoId=Q15746-4; Sequence=Displayed; CC Name=2; CC IsoId=Q15746-5; Sequence=VSP_000040; CC Name=3A; CC IsoId=Q15746-6; Sequence=VSP_000041, VSP_000043; CC Name=3B; CC IsoId=Q15746-7; Sequence=VSP_000040, VSP_000041, VSP_000042; CC Name=4; CC IsoId=Q15746-8; Sequence=VSP_000041, VSP_000042; CC Name=del-1790; CC IsoId=Q15746-9; Sequence=VSP_000044; ... FT VARSPLIC 437 506 VSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKA FT RTRDSGTYSCTASNAQGQVSCSWTLQVER -> G (in FT isoform 2 and isoform 3B). FT /FTId=VSP_004791. FT VARSPLIC 1433 1439 DEVEVSD -> MKWRCQT (in isoform 3A, FT isoform 3B and isoform 4). FT /FTId=VSP_004792. FT VARSPLIC 1473 1545 Missing (in isoform 4). FT /FTId=VSP_004793. FT VARSPLIC 1655 1705 Missing (in isoform 3A and isoform 3B). FT /FTId=VSP_004794. FT VARSPLIC 1790 1790 Missing (in isoform Del-1790). FT /FTId=VSP_004795. ...The corresponding modules of the Swiss-Prot parser Swissknife have been modified, and Release 1.31 of Swissknife can be downloaded.
| Data bank identifier: | GO |
| Primary identifier: | GO's unique identifier for a GO term. |
| Secondary identifier: | A 1-letter abbreviation for one of the 3 ontology aspects, separated from the GO term by a column. If the term is longer than 46 characters, the first 43 characters are indicated followed by 3 dots ('...'). The abbreviations for the 3 distinct aspects of the ontology are P (biological Process), F (molecular Function), and C (cellular Component). |
| Tertiary identifier: | 3-character GO evidence code. The meaning of the evidence codes is: IDA=inferred from direct assay, IMP=inferred from mutant phenotype, IGI=inferred from genetic interaction, IPI=inferred from physical interaction, IEP=inferred from expression pattern, TAS=traceable author statement, NAS=non-traceable author statement, IC=inferred by curator, ISS=inferred from sequence or structural similarity. |
| Examples: | Q9XTD2 DR GO; GO:0008601; F:protein phosphatase type 2A, regulator acti...; IPI. DR GO; GO:0000080; P:G1 phase of mitotic cell cycle; IDA. DR GO; GO:0008285; P:negative regulation of cell proliferation; IDA. DR GO; GO:0006470; P:protein amino acid dephosphorylation; IDA. P04406: DR GO; GO:0005737; C:cytoplasm; NAS. DR GO; GO:0004365; F:glyceraldehyde 3-phosphate dehydrogenase (p...; NAS. DR GO; GO:0006096; P:glycolysis; NAS. |
| Release 41.0, 28-Feb-2003 |
|---|
RP SEQUENCE FROM N.A., SEQUENCE OF 23-42 AND 351-365, AND RP CHARACTERIZATION.
| Data bank identifier: | GeneDB_SPombe |
| Primary identifier: | GeneDB's unique identifier for a S. pombe gene. |
| Secondary identifier: | None; a dash '-' is stored in that field. |
| Example: | DR GeneDB_SPombe; SPAC9E9.12c; -. |
| Data bank identifier: | Genew |
| Primary identifier: | HGNC's unique identifier for a human gene |
| Secondary identifier: | HGNC's approved gene symbol. |
| Example: | DR Genew; HGNC:5217; HSD3B1. |
| Data bank identifier: | Gramene |
| Primary identifier: | Unique identifier for a protein, which is identical to the Swiss-Prot primary AC number of that protein. |
| Secondary identifier: | None; a dash '-' is stored in that field. |
| Example: | DR Gramene; Q06967; -. |
| Data bank identifier: | HAMAP |
| Primary identifier: | HAMAP unique identifier for a microbe protein family |
| Secondary identifier: | The values are either '-', 'fused', 'atypical' or 'atypical/fused'. The value '-' is a placeholder for an empty field; the 'fused' value indicates that the family rule does not cover the entire protein; the value 'atypical' points out that the protein is divergent in sequence or has mutated functional sites, and should not be included in family datasets. The value 'atypical/fused' indicates both latter findings. |
| Tertiary identifier: | Number of domains found in the protein, generally '1', rarely '2' for the fusion of 2 identical domains. |
| Example: | DR HAMAP; MF_00012; -; 1. |
| Data bank identifier: | PhosSite |
| Primary identifier: | Unique identifier for a phosphoprotein, which is identical to the Swiss-Prot primary AC number of that protein. |
| Secondary identifier: | None; a dash '-' is stored in that field. |
| Example: | DR PhosSite; P00955; -. |
| Data bank identifier: | TIGRFAMs |
| Primary identifier: | TIGRFAMs unique identifier for a protein family. |
| Secondary identifier: | TIGRFAMs entry name for a protein family. |
| Tertiary identifier: | Number of hits found in the sequence. |
| Example: | DR TIGRFAMs; TIGR00630; uvra; 1. |
FT VARIANT from to description (IN dbSNP:accession_number). FT /FTId=VAR_number.Example:
FT VARIANT 65 65 T -> I (IN dbSNP:1065419). FT /FTId=VAR_012009.
ExPASy Home page |
Site Map | Search ExPASy | Contact us | Swiss-Prot |
| Hosted by NCSC US | Mirror sites: | Canada | China | Korea | Switzerland | Taiwan |