Results from PredictProtein for HMGL_HUMAN

single protein sequence description=HMGL_HUMAN

MAAMRKALPR RLVGLASLRA VSTSSMGTLP KRVKIVEVGP RDGLQNEKNI VSTPVKIKLI
DMLSEAGLSV IETTSFVSPK WVPQMGDHTE VLKGIQKFPG INYPVLTPNL KGFEAAVAAG
AKEVVIFGAA SELFTKKNIN CSIEESFQRF DAILKAAQSA NISVRGYVSC ALGCPYEGKI
SPAKVAEVTK KFYSMGCYEI SLGDTIGVGT PGIMKDMLSA VMQEVPLAAL AVHCHDTYGQ
ALTNTLMALQ MGVSVVDSSV AGLGGCPYAQ GASGNLATED LVYMLEGLGI HTGVNLQKLL
EAGNFICQAL NRKTSSKVAQ ATCKL

PHD predictions for HMGL_HUMAN

Different levels of data:

PHDsec summary overall your protein can be classified as:
mixed given the following classes:
- 'all-alpha': %H > 45% AND %E < 5%
- 'all-beta': %H < 5% AND %E > 45%
- 'alpha-beta': %H > 30% AND %E > 20%
- 'mixed': all others

Predicted secondary structure composition for your protein:

%H: 45.2 %E: 13.5 %L: 41.2

Residue composition for your protein:

%A: 10.5	%C: 2.5	%D: 2.8	%E: 5.2	%F: 2.8
%G: 9.2	%H: 1.2	%I: 5.5	%K: 7.1	%L: 9.8
%M: 3.7	%N: 3.7	%P: 4.3	%Q: 3.7	%R: 2.8
%S: 7.7	%T: 5.5	%V: 9.2	%W: 0.3	%Y: 2.5

AA : amino acid sequence

PHD_sec: PHD predicted secondary structure: H=helix, E=extended (sheet), blank=other (loop)
PHD = PHD: Profile network prediction HeiDelberg

Rel_sec: reliability index for PHDsec prediction (0=low to 9=high)
Note: for the brief presentation strong predictions marked by '*'

SUB_sec: subset of the PHDsec prediction, for all residues with an expected average accuracy > 82% (tables in header)
NOTE: for this subset the following symbols are used:
L: is loop (for which above ' ' is used)
.: means that no prediction is made for this residue, as the reliability is: Rel < 5

pH_sec: 'probability' for assigning helix (1=high, 0=low)

pE_sec: 'probability' for assigning strand (1=high, 0=low)

pL_sec: 'probability' for assigning neither helix, nor strand (1=high, 0=low)

PHD results (brief)

....,....1....,....2....,....3....,....4....,....5....,....6 AA MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLI PHD_sec HHHHHHHHHHHHHHHHHHHH EEEEEE EHHH Rel_sec ******* ****** * ******* ***** *** ******* ** ....,....7....,....8....,....9....,....10...,....11...,....12 AA DMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAG PHD_sec HHHHH EEEEEEE HHHHHHHH EEE HHHHHHHHH Rel_sec ***** ** ***** *** *** ******* **** *** ******** ....,....13...,....14...,....15...,....16...,....17...,....18 AA AKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKI PHD_sec EEEEEEHHHHHHHH HHHHHHHHHHHHHHHHH EEEEEEEEE Rel_sec ** ***** ***** *** **************** * ******** **** ** ....,....19...,....20...,....21...,....22...,....23...,....24 AA SPAKVAEVTKKFYSMGCYEISLGDTIGVGTPGIMKDMLSAVMQEVPLAALAVHCHDTYGQ PHD_sec HHHHHHHHHHHHH EEEE HHHHHHHHHHHHH HHHE HHHHHHH Rel_sec **************** **** *** **************** ** **** ....,....25...,....26...,....27...,....28...,....29...,....30 AA ALTNTLMALQMGVSVVDSSVAGLGGCPYAQGASGNLATEDLVYMLEGLGIHTGVNLQKLL PHD_sec HHHHHHHHHH EEEEEEE HHHHHHHHHHHH HHHHHHH Rel_sec ********** ******* ******* **** *********** *** * ****** ....,....31...,....32...,....33 AA EAGNFICQALNRKTSSKVAQATCKL PHD_sec HHHHHHHHHHHH Rel_sec *********** ***** **

PHD results (normal)

....,....1....,....2....,....3....,....4....,....5....,....6 AA MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLI PHD_sec HHHHHHHHHHHHHHHHHHHH EEEEEE EHHH Rel_sec 977899837988654543231123579688827999935874221256689983211378 SUB_sec LHHHHHH.HHHHHH.H........LLLLLLL.EEEEE.LLL.....LLLLLLL.....HH ....,....7....,....8....,....9....,....10...,....11...,....12 AA DMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAG PHD_sec HHHHH EEEEEEE HHHHHHHH EEE HHHHHHHHH Rel_sec 999964882789853115674331588499998863489961412476721799999953 SUB_sec HHHHH.LL.EEEEE...LLL....LLL.HHHHHHH..LLLL.....LLL..HHHHHHHH. ....,....13...,....14...,....15...,....16...,....17...,....18 AA AKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKI PHD_sec EEEEEEHHHHHHHH HHHHHHHHHHHHHHHHH EEEEEEEEE Rel_sec 562667753688862116964469999999999999982364575899962357864355 SUB_sec LL.EEEEE.HHHHH...LLL..HHHHHHHHHHHHHHHH..L.EEEEEEEE..LLLL..LL ....,....19...,....20...,....21...,....22...,....23...,....24 AA SPAKVAEVTKKFYSMGCYEISLGDTIGVGTPGIMKDMLSAVMQEVPLAALAVHCHDTYGQ PHD_sec HHHHHHHHHHHHH EEEE HHHHHHHHHHHHH HHHE HHHHHHH Rel_sec 789999999999755948997178514689769999999999718714211110245789 SUB_sec LHHHHHHHHHHHHHLL.EEEE.LLL..LLLLHHHHHHHHHHHH.LL..........HHHH ....,....25...,....26...,....27...,....28...,....29...,....30 AA ALTNTLMALQMGVSVVDSSVAGLGGCPYAQGASGNLATEDLVYMLEGLGIHTGVNLQKLL PHD_sec HHHHHHHHHH EEEEEEE HHHHHHHHHHHH HHHHHHH Rel_sec 999999999749579998414679886645787425999999999737851253589999 SUB_sec HHHHHHHHHH.LLEEEEE...LLLLLLL.LLLL..HHHHHHHHHHH.LLL..L.HHHHHH ....,....31...,....32...,....33 AA EAGNFICQALNRKTSSKVAQATCKL PHD_sec HHHHHHHHHHHH Rel_sec 9979999999516999632222369 SUB_sec HHHHHHHHHHH.LLLLL......LL

PHD results (detail)

....,....1....,....2....,....3....,....4....,....5....,....6 AA MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLI pH_sec . 1.0 pH_sec ...... ... .. 0.9 pH_sec ...... .... .. 0.8 pH_sec ............. . .. 0.7 pH_sec ................. . ... 0.6 pH_sec .................... .... ... 0.5 pH_sec ..................... ..... . .... 0.4 pH_sec ....................... ........ .. .... 0.3 pH_sec ....................... . ......... ....... 0.2 ------------------------------------------------------------ pE_sec ... 1.0 pE_sec ..... 0.9 pE_sec ..... 0.8 pE_sec ...... 0.7 pE_sec ...... 0.6 pE_sec ...... 0.5 pE_sec .. . ....... ... 0.4 pE_sec .......... . ........ .... 0.3 pE_sec ............. .. ........ ...... 0.2 ------------------------------------------------------------ pL_sec . .. 1.0 pL_sec . .. ... .. .... 0.9 pL_sec . ...... ... ...... 0.8 pL_sec . ....... .... ........ 0.7 pL_sec . ........ ................ 0.6 pL_sec . .......... .................. 0.5 pL_sec . . ............ ................... 0.4 pL_sec . .. .. .............. .................... 0.3 pL_sec ... ........................... .................... 0.2 ------------------------------------------------------------ ....,....7....,....8....,....9....,....10...,....11...,....12 AA DMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAG pH_sec ... .... ...... 1.0 pH_sec .... ...... ....... 0.9 pH_sec ..... ....... ........ 0.8 pH_sec ..... ........ ........ 0.7 pH_sec ..... .. ........ ......... 0.6 pH_sec ..... .. ........ .......... 0.5 pH_sec ...... ... .......... ........... 0.4 pH_sec ...... ..... .......... ........... 0.3 pH_sec .......... ................... ............ 0.2 ------------------------------------------------------------ pE_sec . 1.0 pE_sec ... 0.9 pE_sec ..... 0.8 pE_sec ..... . 0.7 pE_sec ....... .. 0.6 pE_sec ........ ... 0.5 pE_sec ......... ..... 0.4 pE_sec ........... ...... 0.3 pE_sec ............ ........ 0.2 ------------------------------------------------------------ pL_sec .. 1.0 pL_sec .. .. ... 0.9 pL_sec .. ... .. .... ... 0.8 pL_sec ... .... ... ...... .... 0.7 pL_sec .... ..... ... ...... ...... . 0.6 pL_sec .... ....... .... ....... ........ . 0.5 pL_sec .... .............. ................ . 0.4 pL_sec ..... ............... ................. .. 0.3 pL_sec ...... ................ .................... .. 0.2 ------------------------------------------------------------ ....,....13...,....14...,....15...,....16...,....17...,....18 AA AKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKI pH_sec .. .......... 1.0 pH_sec ... ............... 0.9 pH_sec ..... ................ 0.8 pH_sec ..... ................ 0.7 pH_sec ........ ................. 0.6 pH_sec ......... ................. 0.5 pH_sec ......... .................. 0.4 pH_sec . .......... .................. 0.3 pH_sec .. . ............ ..................... . . 0.2 ------------------------------------------------------------ pE_sec .. 1.0 pE_sec . . .... 0.9 pE_sec .... ........ 0.8 pE_sec ..... ........ 0.7 pE_sec ...... ......... 0.6 pE_sec ...... ......... 0.5 pE_sec ...... .......... . 0.4 pE_sec ...... .. ............ ... 0.3 pE_sec ....... ... ............. ..... 0.2 ------------------------------------------------------------ pL_sec 1.0 pL_sec . . 0.9 pL_sec . ... . .... . 0.8 pL_sec .. ..... ... ......... 0.7 pL_sec .. ...... ... ......... 0.6 pL_sec .. ....... ... .......... 0.5 pL_sec ... ........ .... .......... 0.4 pL_sec .... .. ......... ..... . ........... 0.3 pL_sec ....................... ......... ........... 0.2 ------------------------------------------------------------ ....,....19...,....20...,....21...,....22...,....23...,....24 AA SPAKVAEVTKKFYSMGCYEISLGDTIGVGTPGIMKDMLSAVMQEVPLAALAVHCHDTYGQ pH_sec .......... .......... . 1.0 pH_sec ............ ........... ... 0.9 pH_sec ............ ............ .... 0.8 pH_sec ............. ............ ..... 0.7 pH_sec ............. ............. .. ...... 0.6 pH_sec ............. ............. ... . ....... 0.5 pH_sec ............. ............. .............. 0.4 pH_sec .............. ............. .............. 0.3 pH_sec ............... . .............. ............... 0.2 ------------------------------------------------------------ pE_sec 1.0 pE_sec ... 0.9 pE_sec .... 0.8 pE_sec .... 0.7 pE_sec .... 0.6 pE_sec ..... . 0.5 pE_sec ...... . ... 0.4 pE_sec ...... .... .... 0.3 pE_sec ....... ..... ....... 0.2 ------------------------------------------------------------ pL_sec . . 1.0 pL_sec . . .. ... . 0.9 pL_sec . .. .. .... .. 0.8 pL_sec . ... ... ..... .. 0.7 pL_sec . ... .... ..... .. 0.6 pL_sec . ... .......... .... .. 0.5 pL_sec . ... .......... .... ..... 0.4 pL_sec . .... ........... ..... ........ 0.3 pL_sec .. ...... ............ ................. 0.2 ------------------------------------------------------------ ....,....25...,....26...,....27...,....28...,....29...,....30 AA ALTNTLMALQMGVSVVDSSVAGLGGCPYAQGASGNLATEDLVYMLEGLGIHTGVNLQKLL pH_sec ......... ........ .... 1.0 pH_sec ......... ......... ..... 0.9 pH_sec .......... ........... ..... 0.8 pH_sec .......... ............ ....... 0.7 pH_sec .......... ............ ....... 0.6 pH_sec .......... ............. ....... 0.5 pH_sec ........... .............. . ....... 0.4 pH_sec ........... ... .............. ........... 0.3 pH_sec ........... .... .................................... 0.2 ------------------------------------------------------------ pE_sec .. 1.0 pE_sec ..... 0.9 pE_sec ..... 0.8 pE_sec ...... 0.7 pE_sec ...... 0.6 pE_sec ....... 0.5 pE_sec ....... 0.4 pE_sec ......... .. 0.3 pE_sec .......... ... 0.2 ------------------------------------------------------------ pL_sec . . 1.0 pL_sec . ... ... .. 0.9 pL_sec .. ...... ... .. 0.8 pL_sec ... .............. ... . 0.7 pL_sec ... ............... ... . 0.6 pL_sec ... ............... ... .. 0.5 pL_sec ... ................ ........ 0.4 pL_sec ... .................. ......... 0.3 pL_sec ..... .................. .......... 0.2 ------------------------------------------------------------ ....,....31...,....32...,....33 AA EAGNFICQALNRKTSSKVAQATCKL pH_sec .. ....... 1.0 pH_sec .......... 0.9 pH_sec ........... 0.8 pH_sec ........... 0.7 pH_sec ............ 0.6 pH_sec ............ 0.5 pH_sec ............ .... 0.4 pH_sec ............. ..... 0.3 pH_sec ............. ........ 0.2 ------------------------- pE_sec 1.0 pE_sec 0.9 pE_sec 0.8 pE_sec 0.7 pE_sec 0.6 pE_sec 0.5 pE_sec . 0.4 pE_sec ... 0.3 pE_sec ....... 0.2 ------------------------- pL_sec .. . 1.0 pL_sec ... . 0.9 pL_sec ..... .. 0.8 pL_sec ..... .. 0.7 pL_sec ....... ... 0.6 pL_sec .............. 0.5 pL_sec .............. 0.4 pL_sec ............... 0.3 pL_sec . ............... 0.2 -------------------------

END of results for file predict_h5573

Quotes for methods

PredictProtein: PredicProtein: B Rost (1996) Methods in Enzymology, 266:525-539
- Url: http://dodo.cpmc.columbia.edu/
- Version: 1.99.08
- Description: PredictProtein is the acronym for all prediction programs run.
PROSITE: A Bairoch, P Bucher & K Hofmann (1997) Nucleic Acids Research, 25:217-221
- Author: A Bairoch, bairoch@cmu.unige.ch P Bucher & K Hofmann
- Contact: bairoch@cmu.unige.ch
- Url: http://www.expasy.ch/prosite/
- Version: 99.07
- Description: PROSITE is a database of functional motifs. ScanProsite, finds all functional motifs in your sequence that are annotated in the ProSite db.
SEG: J C Wootton & S Federhen (1996) Methods in Enzymology, 266:554-571
- Author: J C Wootton & S Federhen, wootton@ncbi.nlm.nih.gov
- Contact: wootton@ncbi.nlm.nih.gov
- Version: 1994
- Description: SEG divides sequences into regions of low-, and high-complexity. Low-complexity regions typically correspond to 'simple sequences' or 'compositionally-biased' regions.
ProDom: ELL Sonnhammer & D Kahn (1994) Protein Science, 3:482-492
- Author: LL Sonnhammer; J Gouzy, F Corpet, F Servant, D Kahn, dkahn@zyx.toulouse.inra.fr
- Contact: dkahn@zyx.toulouse.inra.fr
- Url: http://protein.toulouse.inra.fr/prodom.html
- Version: 2000.1
- Description: ProDom is a database of putative protein domains. The database is searched with BLAST for domains corresponding to your protein.
MaxHom: MaxHom: C Sander R Schneider (1991) Proteins, 9:56-68
- Author: C Sander & R Schneider, schneider@lion-ag.de
- Contact: schneider@lion-ag.de
- Version: 1.99.04
- Description: MaxHom is a dynamic multiple sequence alignment program which finds similar sequences in a database.
MView: MView: N P Brown, C Leroy & C Sander (1998) Bioinformatics, 14:380-381
- Author: N Brown, nbrown@nimr.mrc.ac.uk
- Contact: nbrown@nimr.mrc.ac.uk
- Url: http://mathbio.nimr.mrc.ac.uk/~nbrown/mview/
- Copyright: Copyright (C) Nigel P. Brown, 1997-1998. All rights reserved.
- Version: 1.40.2
- Description: MView is a program converting multiple sequence alignments into fancy HTML formatted output.
PHD: B Rost (1996) Methods in Enzymology, 266:525-539
- Author: B Rost
- Version: 1.96
- Description: PHD is a suite of programs predicting 1D structure (secondary structure, solvent accessibility) from multiple sequence alignments.
PHDsec: B Rost & C Sander (1993) J. of Molecular Biology, 232:584-599
- Author: B Rost
- Version: 1.96
- Description: PHD predicts secondary structure from multiple sequence alignments.

AA :	amino acid sequence
PHD_sec:	PHD predicted secondary structure: H=helix, E=extended (sheet), blank=other (loop) PHD = PHD: Profile network prediction HeiDelberg
Rel_sec:	reliability index for PHDsec prediction (0=low to 9=high) Note: for the brief presentation strong predictions marked by '*'
SUB_sec:	subset of the PHDsec prediction, for all residues with an expected average accuracy > 82% (tables in header) NOTE: for this subset the following symbols are used: L: is loop (for which above ' ' is used) .: means that no prediction is made for this residue, as the reliability is: Rel < 5

pH_sec:	'probability' for assigning helix (1=high, 0=low)
pE_sec:	'probability' for assigning strand (1=high, 0=low)
pL_sec:	'probability' for assigning neither helix, nor strand (1=high, 0=low)