BLASTP 2.2.5 [Nov-16-2002]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1049739182-023582-29814 Query= tr|O26773 Hypothetical protein MTH677 - Methanobacterium thermoautotrophicum. (91 letters) Database: PDB protein database 40,221 sequences; 9,510,823 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports
RID: 1049739182-023582-29814
Query= tr|O26773 Hypothetical protein MTH677 - Methanobacterium thermoautotrophicum. (91 letters)
Database: PDB protein database 40,221 sequences; 9,510,823 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|1127268|pdb|1GGT|A Chain A, Coagulation Factor Xiii (A-S... 27 1.3 gi|442689|pdb|1BSR|A Chain A, Ribonuclease (Bovine, Seminal... 27 1.8 gi|4930049|pdb|1ILE| Isoleucyl-Trna Synthetase >gi|1815885... 26 2.3 gi|21730846|pdb|1LS5|A Chain A, Crystal Structure Of Plasme... 24 9.5 Alignments >gi|1127268|pdb|1GGT|A Chain A, Coagulation Factor Xiii (A-Subunit Zymogen) (E.C.2.3.2.13) (Protein-Glutamine Gamma-Glutamyltransferase A Chain) gi|1127269|pdb|1GGT|B Chain B, Coagulation Factor Xiii (A-Subunit Zymogen) (E.C.2.3.2.13) (Protein-Glutamine Gamma-Glutamyltransferase A Chain) gi|3660202|pdb|1F13|A Chain A, Recombinant Human Cellular Coagulation Factor Xiii gi|3660203|pdb|1F13|B Chain B, Recombinant Human Cellular Coagulation Factor Xiii gi|4558162|pdb|1GGU|A Chain A, Human Factor Xiii With Calcium Bound In The Ion Site gi|4558164|pdb|1GGY|A Chain A, Human Factor Xiii With Ytterbium Bound In The Ion Site gi|4558165|pdb|1GGY|B Chain B, Human Factor Xiii With Ytterbium Bound In The Ion Site gi|5542457|pdb|1QRK|A Chain A, Human Factor Xiii With Strontium Bound In The Ion Site gi|5542458|pdb|1QRK|B Chain B, Human Factor Xiii With Strontium Bound In The Ion Site gi|6729802|pdb|1GGU|B Chain B, Human Factor Xiii With Calcium Bound In The Ion Site Length = 731 Score = 26.9 bits (58), Expect = 1.3 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 21 TISDFILKRVSAKEIVDIDITVLVEYTDELK 51 TI + I+K V ++V D+TV VE+T+ LK Sbjct: 628 TIPEIIIK-VRGTQVVGSDMTVTVEFTNPLK 657 >gi|442689|pdb|1BSR|A Chain A, Ribonuclease (Bovine, Seminal) (Bs-Rnase) gi|442690|pdb|1BSR|B Chain B, Ribonuclease (Bovine, Seminal) (Bs-Rnase) gi|4699630|pdb|11BA|A Chain A, Binding Of A Substrate Analogue To A Domain Swapping Protein In The Complex Of Bovine Seminal Ribonuclease With Uridylyl-2',5'-Adenosine gi|4699631|pdb|11BA|B Chain B, Binding Of A Substrate Analogue To A Domain Swapping Protein In The Complex Of Bovine Seminal Ribonuclease With Uridylyl-2',5'-Adenosine gi|6573660|pdb|11BG|A Chain A, A Potential Allosteric Subsite Generated By Domain Swapping In Bovine Seminal Ribonuclease gi|6573661|pdb|11BG|B Chain B, A Potential Allosteric Subsite Generated By Domain Swapping In Bovine Seminal Ribonuclease Length = 124 Score = 26.6 bits (57), Expect = 1.8 Identities = 8/24 (33%), Positives = 17/24 (70%) Query: 1 MSLRKLTEGDLDEISSFLHNTISD 24 M RK+T+G +++F+H +++D Sbjct: 30 MCCRKMTQGKCKPVNTFVHESLAD 53 >gi|4930049|pdb|1ILE| Isoleucyl-Trna Synthetase gi|18158855|pdb|1JZQ|A Chain A, Isoleucyl-Trna Synthetase Complexed With Isoleucyl- Adenylate Analogue gi|18158860|pdb|1JZS|A Chain A, Isoleucyl-Trna Synthetase Complexed With Mupirocin Length = 821 Score = 26.2 bits (56), Expect = 2.3 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 50 LKVDISAELYLDELSDADPGIVDEAVDAAYRSLESFLD 87 ++++ ++L + +ADP + DEA+ A R++ +D Sbjct: 773 VRLEAKESVHLADWPEADPALADEALVAQMRAVLKVVD 810 >gi|21730846|pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A gi|21730847|pdb|1LS5|B Chain B, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A Length = 328 Score = 23.9 bits (50), Expect = 9.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 39 DITVLVEYTDELKVDISAELYLDELSDADPGI 70 D+ L ++ K + E Y+D LSD DP + Sbjct: 253 DLPTLEFHSRNNKYTLEPEFYMDPLSDIDPAL 284
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|1127268|pdb|1GGT|A Chain A, Coagulation Factor Xiii (A-S... 27 1.3 gi|442689|pdb|1BSR|A Chain A, Ribonuclease (Bovine, Seminal... 27 1.8 gi|4930049|pdb|1ILE| Isoleucyl-Trna Synthetase >gi|1815885... 26 2.3 gi|21730846|pdb|1LS5|A Chain A, Crystal Structure Of Plasme... 24 9.5
>gi|1127268|pdb|1GGT|A Chain A, Coagulation Factor Xiii (A-Subunit Zymogen) (E.C.2.3.2.13) (Protein-Glutamine Gamma-Glutamyltransferase A Chain) gi|1127269|pdb|1GGT|B Chain B, Coagulation Factor Xiii (A-Subunit Zymogen) (E.C.2.3.2.13) (Protein-Glutamine Gamma-Glutamyltransferase A Chain) gi|3660202|pdb|1F13|A Chain A, Recombinant Human Cellular Coagulation Factor Xiii gi|3660203|pdb|1F13|B Chain B, Recombinant Human Cellular Coagulation Factor Xiii gi|4558162|pdb|1GGU|A Chain A, Human Factor Xiii With Calcium Bound In The Ion Site gi|4558164|pdb|1GGY|A Chain A, Human Factor Xiii With Ytterbium Bound In The Ion Site gi|4558165|pdb|1GGY|B Chain B, Human Factor Xiii With Ytterbium Bound In The Ion Site gi|5542457|pdb|1QRK|A Chain A, Human Factor Xiii With Strontium Bound In The Ion Site gi|5542458|pdb|1QRK|B Chain B, Human Factor Xiii With Strontium Bound In The Ion Site gi|6729802|pdb|1GGU|B Chain B, Human Factor Xiii With Calcium Bound In The Ion Site Length = 731 Score = 26.9 bits (58), Expect = 1.3 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 21 TISDFILKRVSAKEIVDIDITVLVEYTDELK 51 TI + I+K V ++V D+TV VE+T+ LK Sbjct: 628 TIPEIIIK-VRGTQVVGSDMTVTVEFTNPLK 657
>gi|442689|pdb|1BSR|A Chain A, Ribonuclease (Bovine, Seminal) (Bs-Rnase) gi|442690|pdb|1BSR|B Chain B, Ribonuclease (Bovine, Seminal) (Bs-Rnase) gi|4699630|pdb|11BA|A Chain A, Binding Of A Substrate Analogue To A Domain Swapping Protein In The Complex Of Bovine Seminal Ribonuclease With Uridylyl-2',5'-Adenosine gi|4699631|pdb|11BA|B Chain B, Binding Of A Substrate Analogue To A Domain Swapping Protein In The Complex Of Bovine Seminal Ribonuclease With Uridylyl-2',5'-Adenosine gi|6573660|pdb|11BG|A Chain A, A Potential Allosteric Subsite Generated By Domain Swapping In Bovine Seminal Ribonuclease gi|6573661|pdb|11BG|B Chain B, A Potential Allosteric Subsite Generated By Domain Swapping In Bovine Seminal Ribonuclease Length = 124 Score = 26.6 bits (57), Expect = 1.8 Identities = 8/24 (33%), Positives = 17/24 (70%) Query: 1 MSLRKLTEGDLDEISSFLHNTISD 24 M RK+T+G +++F+H +++D Sbjct: 30 MCCRKMTQGKCKPVNTFVHESLAD 53
>gi|4930049|pdb|1ILE| Isoleucyl-Trna Synthetase gi|18158855|pdb|1JZQ|A Chain A, Isoleucyl-Trna Synthetase Complexed With Isoleucyl- Adenylate Analogue gi|18158860|pdb|1JZS|A Chain A, Isoleucyl-Trna Synthetase Complexed With Mupirocin Length = 821 Score = 26.2 bits (56), Expect = 2.3 Identities = 10/38 (26%), Positives = 23/38 (60%) Query: 50 LKVDISAELYLDELSDADPGIVDEAVDAAYRSLESFLD 87 ++++ ++L + +ADP + DEA+ A R++ +D Sbjct: 773 VRLEAKESVHLADWPEADPALADEALVAQMRAVLKVVD 810
>gi|21730846|pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A gi|21730847|pdb|1LS5|B Chain B, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A Length = 328 Score = 23.9 bits (50), Expect = 9.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 39 DITVLVEYTDELKVDISAELYLDELSDADPGI 70 D+ L ++ K + E Y+D LSD DP + Sbjct: 253 DLPTLEFHSRNNKYTLEPEFYMDPLSDIDPAL 284
Database: PDB protein database Posted date: Apr 7, 2003 2:19 AM Number of letters in database: 9,510,823 Number of sequences in database: 40,221 Lambda K H 0.316 0.138 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 501,432 Number of Sequences: 40221 Number of extensions: 16484 Number of successful extensions: 64 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 58 Number of HSP's gapped (non-prelim): 7 length of query: 91 length of database: 9,510,823 effective HSP length: 67 effective length of query: 24 effective length of database: 6,816,016 effective search space: 163584384 effective search space used: 163584384 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
