EVA results for 1otr:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....
seq	NDDHESKLSILMDMFPAISKSKLQVHLLENNNDLDLTIGLLLKENDDKS
dssp	---HHHHHHHHHHH-----HHHHHHHHHH-----HHHHHHHHHH-----
jufo	-------HHHHHHHHHHHHHHHHHHHHHH------EEHHHHHH------	+3.5	-0.2	-0.06
phd	----HHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHH------	+12.6	+5.2	+0.04
phdpsi	----HHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHH------	+10.9	+3.7	+0.02
prof_king	-----HHHHHHHHH--H------EEEHH---------H--EE-------	-13.7	-10.4	-0.11
profsec	---HHHHHHHHHHH---------EEHHHH------HHHHHHHHH-----	+10.7	+17.9	+0.20
prospect	--------HHHHHHHHHH----HHHHHHHHH-------EEEE-------	-20.7	-11.4	-0.24
samt99_sec	----HHHHHHHHHH-------HHEEEEE------HHEEEEEE-------	-9.4	+1.6	+0.13
scratch	----HHHHHHHHHH-HHH-H--HEEEEE-------EHHHHHHH------	-5.1	-10.8	-0.05

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)