EVA results for 1kjk:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....
seq	DLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGH
dssp	-----EEE-----EEEE------EEEEE--HHHHHHHHHHHHHHHHH--
apssp	-----EEEE----EEE--------------HHHHHHHHHHHHHHHH---
apssp2	------EEE---EEEEE------------HHHHHHHHHHHHHHHHH---	+4.9	+9.4	+0.18
jpred	------EE----EEEE--------------HHHHHHHHHHHHHHHH---	+8.7	+13.6	+0.28
phd	-----EEE-----EEE------------------EEHHHHHHHEE----	-2.5	-1.0	+0.06
phdpsi	------------EEEE--------------HHHHHHHHHHHHHHHH---	+5.0	-2.0	+0.28
profsec	------------EEEEE------------HHHHHHHHHHHHHHHHH---	+2.3	-4.6	+0.17
psipred	------EEE---EEEEE------------HHHHHHHHHHHHHHHHH---	+3.8	+6.9	+0.16
samt99_sec	------EE----EEEEE------------HHHHHHHHHHHHHHHHH---	+6.8	+14.0	+0.22
sspro2	-----EEEE---EEEEE-----------HHHHHHHHHHHHHHHHHH---	+5.2	+12.0	+0.15

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)