EVA results for 1iyc:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS
dssp	----------------------EEE--EEE-HHH--
jufo	--------EEEEEE----------------------	-11.6	-28.1	-0.17
phd	---------EEEEE--------EE------------	-4.3	-16.7	-0.24
phdpsi	---------EEEEE--------EE------------	-6.0	-18.2	-0.26
prof_king	---------EEEE-----------------------	-9.0	-26.4	-0.23
profsec	--------EEEEEE--------EE------------	-11.0	-23.2	-0.30
prospect	HHHHHH-------------HHHHHH-----HHHH--	-16.1	+1.8	-0.20
samt99_sec	---------EEEE---------EE------------	-5.3	-17.8	-0.28
scratch	--------EEEEEE--------EE------------	-10.6	-21.8	-0.29

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)